| Entrez 84229 | Ensembl ENSG00000159625 | |
|  | ||
| Aliases DRC7, C16orf50, CCDC135, CFAP50, FAP50, Coiled-coil domain-containing protein 135, dynein regulatory complex subunit 7 External IDs MGI: 2685616 HomoloGene: 12996 GeneCards: DRC7 | ||
Coiled-coil domain-containing protein 135, also known as CCDC135, is a protein that in humans is encoded by the CCDC135 gene.
Contents
Gene
CCDC90B is located on chromosome 16 in humans. It is neighbored by:
Structure
This protein is characterized by the presence of two domains.
KKQQEIRAQEKKRLR
CAQFVSDFLTMVPLPDPLKPPSHLYSSTTVLKYQKGNCFDFSTLLCSMLIGSGYDAYCVNGYGSLDLCHMDLTREVCPLTVKPKETIKKEEK VLPKKYTIKPPRDLCSRFEQEQEVKKQQEIRAQEKKRLREEEERLMEAEKAKPDALHGLRVHSWVLVL
The protein has 17 predicted alpha helices sites, a characteristic of coiled-coil proteins, and 1 predicted beta-pleated sheet. The following image shows the predicted regions of alpha helices and beta pleated sheets by two programs STRAP and Quickphyre: Note: the consensus secondary structures are shown. This was carried out by constructing a multiple sequence alignment of the proteins with their secondary structures (as shown below). The predicted regions were then cross checked with the Quickphyre Program.
Homology
LRRC57 is exceedingly well conserved, as shown in the sequence annotation to the right. The sequence annotation was created using 20 orthologs shown in the table below and was prepared using ClustalX2 and ClustalW (a tool at Biology Workbench).
The following table provides a few details on orthologs of the human version of CCDC135. These orthologs were gathered from BLAT. and BLAST searches
Predicted properties
Cellular location
CCDC135 is predicted to be a Cytosol/Nuclear protein with no transmembrane spans or segments. It is predicted to contain at least 56 specific phosphorylation sites which include: 20 Protein Kinase C Phosphorylation sites, 11 Casein Kinase II Phosphorylation sites, and 8 cAMP/cGMP Dependant Phosphorylation sites. The amino acid sequence is also predicted to contain 10 sumoylation sites at positions K236, K236, K45, K773, K499, K679, K249, K167, K540, K445, and K292.
Function
The function of CCDC135 is not yet well understood but it is thought to be involved in teratospermia.
