Supriya Ghosh (Editor)

Coiled coil domain containing protein 135

Updated on
Edit
Like
Comment
Share on FacebookTweet on TwitterShare on LinkedInShare on Reddit
Species
  
Human

Entrez
  
84229

Human
  
Mouse

Ensembl
  
ENSG00000159625

Coiled-coil domain-containing protein 135

Aliases
  
DRC7, C16orf50, CCDC135, CFAP50, FAP50, Coiled-coil domain-containing protein 135, dynein regulatory complex subunit 7

External IDs
  
MGI: 2685616 HomoloGene: 12996 GeneCards: DRC7

Coiled-coil domain-containing protein 135, also known as CCDC135, is a protein that in humans is encoded by the CCDC135 gene.

Contents

Gene

CCDC90B is located on chromosome 16 in humans. It is neighbored by:

  • GPR97, G protein-coupled receptor 97.
  • GPR56, encodes a member of the G protein coupled receptor family (G protein-coupled receptor 56). The gene is implicated in the regulation of brain cortical patterning. The protein binds specifically to transglutaminase 2 in the extracellular space.
  • KATNB1, katanin p80 subunit B 1. An accessory protein that helps targets the enzyme to the centrosome.
  • KIFC3, kinesin family member C3 isoform 3. KIFC3 belongs to the large superfamily of kinesins, molecular motors that use the energy of ATP hydrolysis to translocate cargoes along microtubules.

    • Structure

    This protein is characterized by the presence of two domains.

  • Nuclear localization sequence with a Score of 4 in the amino acids 265-279. The amino acid sequence for this region is:

    • KKQQEIRAQEKKRLR

  • Transglutaminase-like family with an E Value of 0.0018 in the amino acids 149-308. The amino acid sequence for this region is:

    • CAQFVSDFLTMVPLPDPLKPPSHLYSSTTVLKYQKGNCFDFSTLLCSMLIGSGYDAYCVNGYGSLDLCHMDLTREVCPLTVKPKETIKKEEK VLPKKYTIKPPRDLCSRFEQEQEVKKQQEIRAQEKKRLREEEERLMEAEKAKPDALHGLRVHSWVLVL

    The protein has 17 predicted alpha helices sites, a characteristic of coiled-coil proteins, and 1 predicted beta-pleated sheet. The following image shows the predicted regions of alpha helices and beta pleated sheets by two programs STRAP and Quickphyre: Note: the consensus secondary structures are shown. This was carried out by constructing a multiple sequence alignment of the proteins with their secondary structures (as shown below). The predicted regions were then cross checked with the Quickphyre Program.

    Homology

    LRRC57 is exceedingly well conserved, as shown in the sequence annotation to the right. The sequence annotation was created using 20 orthologs shown in the table below and was prepared using ClustalX2 and ClustalW (a tool at Biology Workbench).

    The following table provides a few details on orthologs of the human version of CCDC135. These orthologs were gathered from BLAT. and BLAST searches

    Predicted properties

  • Molecular weight: 103502.53 = 103484.53 + 18 kDa
  • Isoelectric point: 5.358000
  • Transmembrane helices: None
  • Post-translation modifications:

    • Cellular location

    CCDC135 is predicted to be a Cytosol/Nuclear protein with no transmembrane spans or segments. It is predicted to contain at least 56 specific phosphorylation sites which include: 20 Protein Kinase C Phosphorylation sites, 11 Casein Kinase II Phosphorylation sites, and 8 cAMP/cGMP Dependant Phosphorylation sites. The amino acid sequence is also predicted to contain 10 sumoylation sites at positions K236, K236, K45, K773, K499, K679, K249, K167, K540, K445, and K292.

    Function

    The function of CCDC135 is not yet well understood but it is thought to be involved in teratospermia.

    References

    Coiled-coil domain-containing protein 135 Wikipedia
    (Text) CC BY-SA


    Similar Topics