Suvarna Garge (Editor)


Updated on
Share on FacebookTweet on TwitterShare on LinkedInShare on Reddit
Species  Human
Entrez  54470
Human  Mouse
Ensembl  ENSG00000198960
Aliases  ARMCX6, GASP10, armadillo repeat containing, X-linked 6
External IDs  MGI: 2147993 HomoloGene: 10373 GeneCards: ARMCX6

Armadillo repeat containing X-linked 6 is a protein that in humans is encoded by the ARMCX6 gene located on the X-chromosome.


It is one of six armadillo repeats containing X-linked proteins (ARMCX1, ARMCX2, ARMCX3, ARMCX4, ARMCX5, and ARMCX6 (this protein)).

The function of this protein is unknown at this time.

Protein sequence



ARMCX6 is conserved in many eukaryotic organisms.

Secondary Structure

The secondary structure of ARMCX6 is predicted to be similar to cyanase. A comparison of the two sequences is shown below.

10 20 30 40 ....*....|....*....|....*....|....*....|....*.. ARMCX6 231 MLAKSASDLKFPLISEGSGCAKVQVLKPLMGLSEKPVLAGELVGAQM 277 1DW9_A 19 LLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKL 65 + + ++ + + + + + + + + + + ++++


Microarray data show that ARMCX6 is highly expressed during earliest stages of spermatogenesis in mice.


ARMCX6 Wikipedia

Similar Topics
Bonjour Balwyn
Seung hwan Oh
Mauricio Claver Carone