Suvarna Garge

ARMCX6

Updated on
Share on FacebookTweet on TwitterShare on LinkedIn
Species  Human
Entrez  54470
Human  Mouse
Ensembl  ENSG00000198960
ARMCX6
Aliases  ARMCX6, GASP10, armadillo repeat containing, X-linked 6
External IDs  MGI: 2147993 HomoloGene: 10373 GeneCards: ARMCX6

Armadillo repeat containing X-linked 6 is a protein that in humans is encoded by the ARMCX6 gene located on the X-chromosome.

Contents

It is one of six armadillo repeats containing X-linked proteins (ARMCX1, ARMCX2, ARMCX3, ARMCX4, ARMCX5, and ARMCX6 (this protein)).

The function of this protein is unknown at this time.

Protein sequence

1 MGRAREVGWM AAGLMIGAGA CYCVYKLTIG RDDSEKLEEE 41 GEEEWDDDQE LDEEEPDIWF DFETMARPWT EDGDWTEPGA 81 PGGTEDRPSG GGKANRAHPI KQRPFPYEHK NTWSAQNCKN 121 GSCVLDLSKC LFIQGKLLFA EPKDAGFPFS QDINSHLASL 161 SMARNTSPTP DPTVREALCA PDNLNASIES QGQIKMYINE 201 VCRETVSRCC NSFLQQAGLN LLISMTVINN MLAKSASDLK 241 FPLISEGSGC AKVQVLKPLM GLSEKPVLAG ELVGAQMLFS 301 FMSLFIRNGN REILLETPAP

Homology

ARMCX6 is conserved in many eukaryotic organisms.

Secondary Structure

The secondary structure of ARMCX6 is predicted to be similar to cyanase. A comparison of the two sequences is shown below.

10 20 30 40 ....*....|....*....|....*....|....*....|....*.. ARMCX6 231 MLAKSASDLKFPLISEGSGCAKVQVLKPLMGLSEKPVLAGELVGAQM 277 1DW9_A 19 LLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKL 65 + + ++ + + + + + + + + + + ++++

Expression

Microarray data show that ARMCX6 is highly expressed during earliest stages of spermatogenesis in mice.

References

ARMCX6 Wikipedia


Similar Topics
The Prophecy: Uprising
Thomas Buckner
Éric Prat
Topics